HUSLAB

Tutkimusohjekirjan etusivu. Hakemisto erikoisalan, nimen, lyhenteen tai tutkimusnumeron mukaan

B-Vastasyntyneiden aineenvaihduntasairauksien seulonta

13231 B -VasSeu1

Tiedustelut

471 72964

Yhteyshenkilöt

lääkäri Helene Markkanen: helene.markkanenathus.fi / 050 427 1612 ja kemisti Sirpa Ranta: sirpa.rantaathus.fi / 050 427 1869

Indikaatiot

Synnynnäisten aineenvaihduntasairauksien seulonta.

Esivalmistelu

Tutkimusta B -Vasseu1 tilatessa osasto täyttää seuraavat PAKOLLISET lisätiedot: raskauden kesto (rvk, esim. 30), lapsen syntymäpaino (g), tarkka syntymän kellonaika (esim. klo 0944),ravitsemus (valitaan vaihtoehto tai kirjoitetaan tekstikenttään)ja onko saanut verta? Verensiirron lopetuspäivä ja verensiirron lopetuskellonaika, mikäli on ollut verensiirto. EI-PAKOLLISINA lisätietoina ovat lapsen kliiniset esitiedot, jotka on täytettävä silloin, kun on esim. jokin tautiepäily.

Näyte otetaan syntymähetkestä aikaisintaan 48 tunnin jälkeen, ja näyte tulisi ottaa 120 tunnin kuluessa syntymästä. Rajatapauksissa ehdoton minimiaika syntymähetkestä näytteenottoon on 47 tuntia. Tätä aikaisempia näytteitä ei tutkita laboratoriossa. HUOM. Verestä peräisin olevien valmisteiden (punasolut, trombosyytit, immunoglobuliinit, plasma) antamisen jälkeen näyte voidaan ottaa vasta 24 tunnin kuluttua ja verenvaihdon jälkeen 3 vrk kuluttua.

Ihopistosnäytteitä VasSeu1-tutkimusta varten otetaan HUSin alueella Uuden lastensairaalan sekä Naistenklinikan, Jorvin, Porvoon, Lohjan, Hyvinkään, Raaseporin ja Kotkan sairaaloissa ja Tullinpuomin näytteenottoyksikössä. Polikliininen näytteenottovalmius on vain yllä mainituissa yksiköissä, mutta sitä ei ole muissa näytteenottoyksiköissä (ei Kampin, eikä muiden terveyskeskuksien tai muiden sairaaloiden yhteydessä toimivissa HUSLABin toimipisteissä).

Suoritus

Näyte otetaan aina ihopistosnäytteenä kantapäästä (esim. kanyylista otettu näyte ei kelpaa).

Näytteenottokortin näytteenottokohtiin ei saa koskea sormin missään vaiheessa. Lapsen kantapäätä lämmitetään verenkierron lisäämiseksi. Näyte otetaan ihopistosnäytteenä lapsen kantapään sivureunalta (katso näytteenottokortin kääntöpuoli). Näytteeseen ei saa joutua EDTA:ta, hepariinia tai muita lisäaineita. Näytteenottokohta kantapään ihossa puhdistetaan 80 %:lla alkoholilla ja annetaan kuivua. Ihopisto tehdään steriilillä lansetilla, jonka terän syvyys valitaan lapsen koon mukaan (enintään 1,0 mm). Ensimmäinen veripisara pyyhitään pois. Verinäyte otetaan puhtaalla, ei-heparinisoidulla kapillaarilla (100 µl) ja pipetoidaan (näytettä n. 75 µl) näytteenottokortin ympyröidyille näytealueille. Kapillaariin otetaan verta merkkiviivaan asti. Jos näyte valuu huonosti kapillaarista, otetaan uusi kapillaari seuraavaa täplää varten. Verinäytettä kerätään vähintään kolmeen näytteenottokohtaan vain sille puolelle korttia, jossa on pyydetyt henkilötiedot. Imupaperin tulee kostua läpi täpläkohdasta ja veren tulee täyttää koko täpläympyrä molemmin puolin korttia. Yhteen ympyrään annostellaan näytettä vain kerran. Kapillaarilla ei saa koskea näytekortin ympyröityyn näytekohtaan vaan kapillaari laitetaan hyvin lähelle, jolloin näyte imeytyy pintajännityksen vaikutuksesta näyteympyrään.

Näytteeksi riittää kolme onnistuneesti saatua näyteympyrää. Näytetunnistetarra, jossa henkilötunnus, liimataan näytekorttiin ja kirjoitetaan tarkka näytteenottoaika. Jos näytteenotossa on ollut vaikeuksia, näytekorttiin voi kirjoittaa ko. täplän viereen maininnan. Näytekortti toimitetaan mielellään vaakatasossa laboratorioon.

Näytteenottokorttia kuivatetaan laboratoriossa vaakatasossa huoneenlämmössä vähintään 3 tuntia. Näytteen kuivumista ei saa nopeuttaa lisälämmöllä. Ennen lähetystä tarkistetaan, että kaikki näytteet ovat kuivuneet. Työjonoon laittamisesta on erillinen ohje (B -VasSeu-työjono). Näyte lähetetään keltamustaraidallisessa lähetyslaatikossa muovitaskun sisällä (näytekorttia ei saa taittaa näytteen kohdalta) osoitteeseen: Tyks laboratoriot Saske Tunnus 5021812 InfoC932 21006 Vastauslähetys.

Tarvittaessa lisätietoja HUSLABin Erikoiskemian laboratoriosta.

Näyteastia

Katso kohta "Näyte" (Weblab Clinicalissa "Näytteen käs.ohjeet")

Näyte

Näytteenottaja toimittaa näytteen laboratorioon, jossa näytekortin annetaan kuivua vaakatasossa vähintään 3 tuntia ennen näytteen lähettämistä. Näytteen kuivumista ei saa nopeuttaa lisälämmöllä, eikä näytekortti saa olla suorassa auringon valossa. Näytekorttia ei saa taittaa näytteen kohdalta. Pysyvän henkilötunnuksen merkitsemisestä ja työjonon teosta on erillinen ohjeensa näytteitä ottavissa laboratorioissa. Kuivunut näytekortti laitetaan omaan muovipussiin (näytekohta pussin suljetussa päässä) ja sitten vasta kirjekuoreen. Näytteen lähettämisen yhteydessä tarkistettavista ja huomioitavista asioista on kaikissa näitä näytteitä ottavissa laboratorioissa erilliset kirjalliset ohjeet.

Menetelmä

Verinäytteestä, joka otetaan kantapääihopistolla näytekorttiin, määritetään aminohappojen ja rasvahappojen pitoisuuksia sekä hormoniaineenvaihduntaan liittyvien 17alfa-OH-progesteronin ja tyreotropiinin pitoisuudet. Lisäksi tutkitaan SCID-seulontaan (Severe combined immunodeficiency, vaikea kombinoitu immuunivaje) liittyvä TREC-kopioluku. Analyysimenetelmänä käytetään tandem-massaspektrometriaa ja immunokemiaa. Alihankintana teetettävä tutkimus. Alihankintalaboratorioiden akkreditoinnin tilanne löytyy kunkin laboratorion omilta verkkosivuilta.

Tulokset valmiina

Kahden viikon kuluessa

Yleistä

Näyte otetaan, kun lapsi on vähintään 48 tunnin (2 vrk) ikäinen ja näyte tulisi ottaa ennen 120 tunnin ikää (5 vrk).

Tulkinta

Synnynnäiset aineenvaihduntasairaudet ovat harvinaisia sairauksia (esiintyvyys alle n. 1:2000). Näitä sairauksia on vaikea tunnistaa alkuvaiheissa ilman seulontatutkimusta. Niiden hoito on kuitenkin tärkeää aloittaa mahdollisimman varhain, jotta voidaan estää elimistön vauriot sekä lapsen pysyvä, vaikea vammautuminen ja mahdollinen kuolema. Vain tutkimalla kaikki vastasyntyneet löydetään varmasti ne sairaat lapset, joille varhainen taudin tunnistaminen ja hoidon aloitus ovat elintärkeitä.

Sosiaali- ja terveysministeriö suosittelee 7.4.2014 kunnille ja sairaanhoitopiireille lähettämässään kirjeessä viiden synnynnäisen aineenvaihduntasairauden (CAH, MCAD, LCHAD, GA 1 ja PKU) seulonnan tarjoamista kaikille Suomessa syntyville lapsille vuodesta 2015 alkaen. Vastasyntyneiden aineenvaihduntasairauksien seulassa etsitään joukkoa hormoni- tai aminohappo- ja rasvahappoaineenvaihdunnan sairauksia ja orgaanisten happojen kertymiseen johtavia sairauksia (Ks. lista alla). Seulontaan kuuluu lisäksi vaikean kombinoidun immuunivajeen seulonta eli SCID-seulonta (severe combined immunodeficiency).

Useimmat näistä sairauksista periytyvät peittyvästi: perintötekijämuutos eli mutaatio siirtyy terveiden kantajien välityksellä sukupolvesta toiseen, ja sairaus ilmenee vain, kun kaksi taudinkantajaa saa yhteisen lapsen ja kumpikin siirtää mutaation jälkeläiselleen. Jokaisessa raskaudessa kantajapariskunnalla on 25 prosentin riski, että lapsi syntyy sairaana. Nämä sairaudet aiheuttavat vakavia häiriöitä aineenvaihdunnassa: osa haittaa energian tuotantoa ja muita elämälle välttämättömiä tapahtumia ja osa johtaa myrkyllisten aineiden kertymiseen. Suureen osaan näistä sairauksista on olemassa hyvin tehoava hoito, joka on useimmiten erityisruokavalio. Ennuste riippuu oleellisesti siitä, paljonko vaurioita on ehtinyt syntyä ennen hoidon aloitusta.

Normaalit tulokset vastataan "Normaali". Poikkeavasta seulontatuloksesta annetaan erillinen lausunto, ja lastenlääkäri ottaa yhteyttä perheeseen. Lääkäri tutkii lapsen ja hänestä otetaan uusi näyte. Jatkotutkimuksilla varmistetaan seulontatutkimuksen tulos.

Oheisessa listassa seulottavat aineenvaihduntataudit:

Aminohappojen aineenvaihdunnan sairaudet

- Fenyyliketonuria (PKU)

- Homokystinuria

- Hyperornitinemia-gyrata-atrofia (HOGA-tauti)

- Tyrosinemia tyyppi 1

- Vaahterasiirappitauti (MSUD)

Endokrinologiset sairaudet

- Synnynnäinen lisämunuaisen liikakasvu (CAH)

Orgaanisten happojen aineenvaihdunnan häiriöt

- Synnynnäinen B12-vitamiinin puutos

- Glutaarihappovirtsaisuus tyyppi I (GA I)

- Isovaleerihappovirtsaisuus

- Metyylimalonihappovirtsaisuus

- Propionihappovirtsaisuus

Rasvahappoaineenvaihdunnan sairaudet:

- CACT (karnitiini-asyylikarnitiinitranslokaasin puutos)

- CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I

- CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II

- CUD (karnitiinin kuljetushäiriö)

- Glutaarihappovirtsaisuus tyyppi II (GA II)

- MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)

- LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency)

- VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)

Ureasyklin häiriöt

- Sitrullinemia

- Arginiinimeripihkahappouria (ASA-uria)

- Argininemia

Ohessa taustaa Sos. ja terveysministeriön suosituksessa mainituista synnynnäisistä aineenvaihduntataudeista:

Synnynnäinen lisämunuaishyperplasia eli lisämunuaisten liikakasvu (Congenital adrenal hyperplasia eli CAH) johtuu viasta lisämunuaisen kuoren ns. steroidihormonien tuotannossa. Synnynnäisen lisämunuaishyperplasian riski on noin 1:10000-1:20000. Synnynnäinen lisämunuaisten liikakasvu kehittyy, jos lapselta puuttuu lisämunuaisen entsyymi, jota tarvitaan hormonien käsittelyssä.

PKU eli fenyyliketonuria on länsimaiden yleisin aineenvaihduntatauti, mutta sitä on Suomessa esiintynyt muita maita vähemmän. PKU:ssa elimistöstä puuttuu fenyylialaniini -nimisen aminohapon aineenvaihduntaa säätelevä PAH-entsyymi. Korkea fenyylialaniinipitoisuus on erittäin haitallista kehittyvän lapsen keskushermostolle ja PKU johtaakin hoitamattomana kehitysvammaan. Jos vauvan korkea fenyylialaniinipitoisuus havaitaan varhain, voidaan oikealla ruokavaliolla ja erityisravintovalmisteilla turvata normaali kasvu ja kehitys. Suomessa on alle 20 PKU-potilasta.

LCHAD-puutos ja MCAD-puutos kuuluvat tautiryhmään, jossa elimistön rasvahappojen beeta-oksidaatio eli energiantuotanto on häiriytynyt. LCHAD-puutos (Long chain 3-hydroksi-asyyli-CoA dehydrogenaasin puutos) on niistä maassamme tavallisempi ja se aiheuttaa äkillisiä ja vaikeita aineenvaihduntakriisejä, jonka tyypillinen piirre on hyvin matala verensokeripitoisuus. Lisäksi taudissa esiintyy maksan toiminnan häiriö ja lihasvelttoutta. MCAD-puutos (Medium chain asyyli-CoA dehydrogenaasin puutos) on LCHAD-puutosta lievempi, maailmalla yleisempi, mutta Suomessa harvinaisempi tautimuoto.

GA-1 (Glutaric aciduria I) on harvinainen aineenvaihduntasairaus, jossa GCD-entsyymin puute johtaa glutaarihapon kertymiseen kudoksiin. Ensimmäisten viikkojen tai kuukausien ajan lapsi voi vaikuttaa terveeltä, mutta myöhemmin, tyypillisesti kuumetaudin laukaisemana, kehittyy vaikea aineenvaihduntakriisi, johon usein liittyy kouristeluja ja muita vaikeita aivoperäisiä oireita.

Huomautuksia

Ihopistosnäytteitä VasSeu1-tutkimusta varten otetaan HUSin alueella Uuden lastensairaalan sekä Naistenklinikan, Jorvin, Porvoon, Lohjan, Hyvinkään, Raaseporin ja Kotkan sairaaloissa ja Tullinpuomin näytteenottoyksikössä. Polikliininen näytteenottovalmius on vain yllä mainituissa yksiköissä, mutta sitä ei ole muissa näytteenottoyksiköissä (ei Kampin, eikä muiden terveyskeskuksien tai muiden sairaaloiden yhteydessä toimivissa HUSLABin toimipisteissä).

Tutkimus on käytössä kaikissa em. sairaaloissa lukuunottamatta Hyvinkään sairaalaa.

Tutkimus B -VasSeu1 päivitetty 04.10.2019 / HM

Sivun alkuun

© HUSLAB-liikelaitos. Ohjekirjajärjestelmästä vastaa Janne Suvisaari.
Ohjekirjasivuston viimeisin automaattinen päivitys: 17.10.2019 klo 01:09.